PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peaxi162Scf00269g00088.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia
Family MYB_related
Protein Properties Length: 330aa    MW: 37817.5 Da    PI: 6.432
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peaxi162Scf00269g00088.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.81e-171461148
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
           Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                              +g+WT+eEd +l+++++ +G+g+W+  ++  g+ R++k+c++rw +yl
  Peaxi162Scf00269g00088.1 14 KGPWTPEEDHKLIQYIQVHGPGNWRNLPKNAGLQRCGKSCRLRWTNYL 61
                              79********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.2E-26564IPR009057Homeodomain-like
PROSITE profilePS5129426.278965IPR017930Myb domain
SuperFamilySSF466892.51E-231197IPR009057Homeodomain-like
SMARTSM007171.8E-131363IPR001005SANT/Myb domain
PfamPF002491.4E-161461IPR001005SANT/Myb domain
CDDcd001677.27E-121661No hitNo description
Gene3DG3DSA:1.10.10.605.9E-1165105IPR009057Homeodomain-like
PROSITE profilePS512947.34266105IPR017930Myb domain
SMARTSM007170.0166103IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 330 aa     Download sequence    Send to blast
MGRSPCCDKN GLKKGPWTPE EDHKLIQYIQ VHGPGNWRNL PKNAGLQRCG KSCRLRWTNY  60
LRPDIRRGRF SFEEEETIIQ LHSVLGNKTD NEIKNYWNTH IRKRLLRMGI DPVTHSPRLD  120
FLDLSSLLNS TQLNLSSLLG LQALVNPEIL KLANTLFLPH SENQELLLLK LQENQLLNPQ  180
HIQNSEGPEM LLQKLLQSQL VNSPLHNQSS IFQHNTNQIH NQIPEIPNCT QQNVSCSSSQ  240
SMQGNMGRYL MNGQIFQENM MLPPQNYSHT STPDASENST FQSLNNSSNQ NSQNFSFDTP  300
LSGTEEEKES YCSNFMKFEI PESLDFDDLL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1msf_C9e-21121052105C-Myb DNA-Binding Domain
1mse_C9e-21121052105C-Myb DNA-Binding Domain
1gv2_A1e-20121052105MYB PROTO-ONCOGENE PROTEIN
1h8a_C2e-201210525128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2447211e-51AC244721.5 Solanum lycopersicum strain Heinz 1706 chromosome 10 clone hba-58o17 map 10, complete sequence.
GenBankHG9754491e-51HG975449.1 Solanum pennellii chromosome ch10, complete genome.
GenBankHG9755221e-51HG975522.1 Solanum lycopersicum chromosome ch10, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009774387.11e-165PREDICTED: transcription factor MYB34-like
RefseqXP_016451723.11e-165PREDICTED: transcription factor MYB34-like
TrEMBLK4CY471e-157K4CY47_SOLLC; Uncharacterized protein
STRINGSolyc10g008700.1.11e-156(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12242154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G21440.15e-80MYB-like 102